Compositions
Music Compositions
Audio Examples on Youtube
This work is created from an amino acid chain associated with Dalbergia congestiflora: MEDYQIYLELDRSRQQNFLYPLIFREYIYGLAY…
Based on fish counts on the Snake river
Kendall Feeney and Margaret Brink, pianists
Margaret Brink, pianist
List of Works
Orchestral
Radiant Peaks: from Mineral Ridge to Blossom Mountain (2006-07)
Reciprocal Refractions (2006-07)
Redwoods Symphony, mvt. I : Melancholia (2005). Recorded on ERM Masterworks vol. 11
Chamber
Mission to Mars (2022) for piano
Raw Wood (2018) for marimba
Hollow (2018) for marimba. Recorded on Origin Classical
Kauppi Suite (2015) for string quartet
Crystal-Gazing (2002) for piano
Second Variation on a Theme by Walton (2015) for woodwind quintet
Proteomics (2013) for clarinet, percussion, and piano
Bluebacks from Redfish Lake (2008) for piano four-hands
Dreaming Among Thermal Pools and Concentric Spirals (2006) for bassoon and cello
China Song (2001) earhu – marimba – vibraphone – glockenspiel - crotales
Suite Millennium (2000) Commissioned by the MTNA and Washington State MTA violin - cello - trombone - bassoon - piano -percussion
Organ and Brass Book (1998-1999) Dissertation Piece brass quintet – organ
A Noir (A is Black) (1997) mezzo soprano - harp duo - bass clarinet – cello
Past and Present (1997) harp duo
Variation is the Mother of Invention (1996) piano solo
Here is a Fruit Pianobass Study No. 4 (1997) two pianos
Surround(id) Pianobass Study No. 3 (1996) two pianos
Visions Pianobass Study No. 2 (1995) two pianos
I believe I'll go back home (1995) marimba - percussion – piano
Travelling Pianobass Study No. 1 (1994) two pianos
Recordings
Hollow One of two compositions base on Rosewood Dalbergia stevensonii and congestiflora DNA and protein structures and featured on the “Time Frames” CD by percussionist Michael Waldrop: released on Origin Classical in 2021.
Radiant Peaks ERM Media “Made in the Americas,” vol. 1 Released December 2008; Millennium Symphony, Robert Ian Winstin conducting.
Reciprocal Refractions Recorded November 2007 for ERM Media “Masterworks of the New Era,” vol. 17 with the Kiev Philharmonic, Robert Ian Winstin conducting.
Redwoods Symphony, mvt. I ERM Media “Masterworks of the New Era” vol. 11 Czech Philharmonic, Robert Ian Winstin conducting (released October 2007).
Dreaming among Thermal Pools and Concentric Spirals “Soak” recorded by Drs. John Marshall and Lynne Feller Marshall; available from CD Baby at http://cdbaby.com or iTunes (released December 2006).
Copies of scores and parts can be ordered by sending me an email.
Excerpts of Compositions
The imbedded media players below will provide short audio clips of my music. Many musical moments are derived from nature by using data with algorithms. Other moments are derived from stream-of-consciousness and reflections of music I like. Both methods of expression come spontaneous processes, which can be understood in more detail from my textbook.
Redwoods Symphony Excerpt (based on the DNA sequence tctcaagcac ataaaaaggc...)
EWU Symphony Orchestra
Hollow Excerpt (middle section)
Michael Waldrop, marimba
Raw Wood Excerpt
Michael Waldrop, marimba
Mission to Mars Excerpt (with references and quotes from Chopin's Nocturne op.37/1)
Scott Rednour, piano * Live Recording EWU 2022
Theme and Variations Excerpt (Theme with Var. 1-3 of 10)
Live Recording June 4, 1994, Grande Salle, Royal Conservatory of Music of Liège, Belgium: Tomoko Kiba, violin and Paulo Alvarez, piano. Theme from Stravinsky's "Serenata." Photo of Dungeness River Olympic NP.
Pianobass Study No. 1 Complete
Live Recording June 4, 1994, Grande Salle, Royal Conservatory of Music of Liège, Belgium: Frederic Rzewski and Anne Piret, piano fourhands. The work is based on stream-of-consciousness. Photo of Clover Lake (Mt. Rainier)