Compositions

This work is created from an amino acid chain associated with Dalbergia congestiflora:  MEDYQIYLELDRSRQQNFLYPLIFREYIYGLAY…

Based on fish counts on the Snake river

Kendall Feeney and Margaret Brink, pianists

Margaret Brink, pianist

Radiant  Peaks: from Mineral Ridge to Blossom Mountain (2006-07)

Reciprocal Refractions  (2006-07)

Mission to Mars (2022) for piano

Raw Wood (2018) for marimba

Hollow (2018) for marimba. Recorded on Origin Classical

Kauppi Suite (2015) for string quartet

Crystal-Gazing (2002) for piano

Second Variation on a Theme by Walton (2015) for woodwind quintet

Proteomics (2013)  for clarinet, percussion, and piano

Bluebacks from Redfish Lake (2008) for piano four-hands

Dreaming Among Thermal Pools and Concentric Spirals (2006) for bassoon and cello

China Song (2001) earhu – marimba – vibraphone – glockenspiel - crotales

 Suite Millennium (2000) Commissioned by the MTNA and Washington State MTA violin - cello - trombone - bassoon - piano -percussion

Organ and Brass Book (1998-1999) Dissertation Piece brass quintet – organ

A Noir (A is Black) (1997) mezzo soprano - harp duo - bass clarinet – cello

 Past and Present (1997) harp duo

Variation is the Mother of Invention (1996) piano solo 

Here is a Fruit Pianobass Study No. 4 (1997) two pianos 

Surround(id) Pianobass Study No. 3 (1996) two pianos

Visions Pianobass Study No. 2 (1995) two pianos

I believe I'll go back home (1995) marimba - percussion – piano

Travelling Pianobass Study No. 1 (1994) two pianos

Theme and Variations (1994) violin - piano Theme attributed to Pergolesi and adapted by Stravinsky 

Recordings 

Hollow One of two compositions base on Rosewood Dalbergia stevensonii and congestiflora DNA and protein structures and featured on the “Time Frames” CD by percussionist Michael Waldrop: released on Origin Classical in 2021.   

  

Radiant Peaks ERM Media “Made in the Americas,” vol. 1 Released December 2008; Millennium Symphony, Robert Ian Winstin conducting.  

Reciprocal Refractions  Recorded November 2007 for ERM Media “Masterworks of the New Era,” vol. 17   with the Kiev Philharmonic, Robert Ian Winstin conducting. 

Redwoods Symphony, mvt. I  ERM Media “Masterworks of the New Era” vol. 11 Czech Philharmonic, Robert Ian Winstin conducting (released October 2007). 

Dreaming among Thermal Pools and Concentric Spirals “Soak” recorded by Drs. John Marshall and Lynne Feller Marshall; available  from CD Baby at http://cdbaby.com or iTunes (released December 2006).