Compositions

This work is created from an amino acid chain associated with Dalbergia congestiflora:  MEDYQIYLELDRSRQQNFLYPLIFREYIYGLAY…

Radiant  Peaks: from Mineral Ridge to Blossom Mountain (2006-07)

Reciprocal Refractions  (2006-07)

Mission to Mars (2022) for piano

Raw Wood (2018) for marimba

Hollow (2018) for marimba. Recorded on Origin Classical

Kauppi Suite (2015) for string quartet

Second Variation on a Theme by Walton (2015) for woodwind quintet

Proteomics (2013)  for clarinet, percussion, and piano

Bluebacks from Redfish Lake (2008) for piano four-hands

Dreaming Among Thermal Pools and Concentric Spirals (2006) for bassoon and cello

Crystal-Gazing (2002) for piano

Recordings 

Hollow One of two compositions base on Rosewood Dalbergia stevensonii and congestiflora DNA and protein structures and featured on the “Time Frames” CD by percussionist Michael Waldrop: released on Origin Classical in 2021.   

  

Radiant Peaks ERM Media “Made in the Americas,” vol. 1 Released December 2008; Millennium Symphony, Robert Ian Winstin conducting  

Reciprocal Refractions  Recorded November 2007 for ERM Media “Masterworks of the New Era,” vol. 17   with the Kiev Philharmonic, Robert Ian Winstin conducting  

Redwoods Symphony, mvt. I  ERM Media “Masterworks of the New Era” vol. 11 Czech Philharmonic, Robert Ian Winstin conducting (released October 2007) 

Dreaming among Thermal Pools and Concentric Spirals “Soak” recorded by Drs. John Marshall and Lynne Feller Marshall; available  from CD Baby at http://cdbaby.com or iTunes (released December 2006)